Sars And Tars For Patients Diabetic Test Supplies

Aschafenburg and Mullen Phosphatase Test Buffer

NPD04 PK12
EUR 223.2

Human IgG antibody Laboratories manufactures the sars and tars for patients diabetic test supplies reagents distributed by Genprice. The Sars And Tars For Patients Diabetic Test Supplies reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact SARS Test. Other Sars products are available in stock. Specificity: Sars Category: And Group: Tars For

Ferret Primary Antibody (IgG) Antibody detection and titration and titration ELISA kit, Qualitative (sufficient for 500-1000 tests)

1 kit
EUR 781.2

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 423.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 480
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 390.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 488.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 565.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 594.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 633.

Tars For information

cDNA - Human Diabetic Diseased Tissue: Liver

C1236149Dia 40 reactions
EUR 729

Adipose Subcutaneous Diabetic Disease Lysate

20-105 0.1 mg
EUR 1508.1
Description: Human subcutaneous adipose tissue lysate was prepared by homogenization using a proprietary technique. The tissue was frozen in liquid nitrogen immediately after excision and then stored at -70°C. The human subcutaneous adipose tissue total protein is provided in a buffer including HEPES (pH7.9), MgCl2, KCl, EDTA, Sucrose, Glycerol, Sodium deoxycholate, NP-40, and a cocktail of protease inhibitors. For quality control purposes, the subcutaneous adipose tissue pattern on SDS-PAGE gel is shown to be consistent for each lot by visualization with coomassie blue staining. The subcutaneous adipose tissue is then Western analyzed by either GAPDH or β-actin antibody, and the expression level is consistent with each lot.

cDNA - Human Diabetic Diseased Tissue: Kidney

C1236142Dia 40 reactions
EUR 729

cDNA - Human Diabetic Diseased Tissue: Spleen

C1236246Dia 40 reactions
EUR 729

cDNA - Human Diabetic Diseased Tissue: Stomach

C1236248Dia 40 reactions
EUR 729

cDNA - Human Diabetic Diseased Tissue: Pancreas

C1236188Dia 40 reactions
EUR 729

cDNA - Human Diabetic Diseased Tissue: Esophagus

C1236106Dia 40 reactions
EUR 729

cDNA - Human Diabetic Diseased Tissue: Whole Eye

C1236108Dia-10 10 reactions
EUR 393

cDNA - Human Diabetic Diseased Tissue: Lymph Node

C1236161Dia-10 10 reactions
EUR 393

Skeletal Muscle Membrane Diabetic Disease Lysate

XBL-10855 0.1 mg
EUR 752.1
Description: human skeletal muscle tissue membrane protein lysate was prepared by isolating the membrane protein from whole tissue homogenates using a proprietary technique. The human skeletal muscle tissue was frozen in liquid nitrogen immediately after excision and then stored at -70°C. The membrane protein is provided in a buffer including HEPES (pH 7.9), MgCl2, KCl, EDTA, Sucrose, Glycerol, sodium deoxycholate, NP-40, and a cocktail of protease inhibitors. For quality control purposes, the isolated Skeletal Muscle tissue membrane protein pattern on SDS-PAGE gel is shown to be consistent for each lot by visualization with coomassie blue staining. The isolated Skeletal Muscle tissue membrane protein is then Western analyzed by either GAPDH or β-actin antibody to confirm there is no signal or very weak signal.

cDNA - Human Diabetic Diseased Tissue: Bone Marrow

C1236024Dia-10 10 reactions
EUR 420

Membrane Protein - Diabetic Disease: Skeletal Muscle

P3236171Dia 0.1 mg
EUR 410

Total Protein - Human Diabetic Diseased Tissue: Lung

P1236152Dia 1 mg
EUR 471

Total Protein - Human Diabetic Diseased Tissue: Skin

P1236218Dia 1 mg
EUR 471

Total Protein - Human Diabetic Diseased Tissue: Brain

P1236035Dia 1 mg
EUR 471

Total Protein - Human Diabetic Diseased Tissue: Colon

P1236090Dia 1 mg
EUR 471

Total Protein - Human Diabetic Diseased Tissue: Heart

P1236122Dia 1 mg
EUR 471