Label-free Electrochemical Detection of CGG Repeats on Inkjet Printable 2D Layers of MoS 2

Label-free Electrochemical Detection of CGG Repeats on Inkjet Printable 2D Layers of MoS 2

Versatile and ultrasensitive biosensing platforms able to detecting a lot of trinucleotide repeats (TNRs) are essential for future know-how growth wanted to fight quite a lot of genetic issues. For instance, trinucleotide CGG repeat expansions within the FMR1 gene could cause Fragile X syndrome (FXS) and Fragile X-associated tremor/ataxia syndrome (FXTAS). Present state-of-the-art applied sciences to detect repeat sequences are costly, whereas counting on difficult procedures, and susceptible to false negatives. We reasoned that two-dimensional (2D) molybdenum sulfide (MoS2) surfaces could also be helpful for label-free electrochemical detection of CGG repeats because of its excessive affinity for guanine bases.

Right here, we developed a low-cost and delicate wax-on-plastic electrochemical sensor utilizing 2D MoS2 ink for the detection of CGG repeats. The ink containing few-layered MoS2 nanosheets was ready and characterised utilizing optical, electrical, electrochemical, and electron microscopic strategies. The units have been characterised by electron microscopic and electrochemical strategies. Repetitive CGG DNA was adsorbed on a MoS2 floor in a excessive cationic power atmosphere and the electrocatalytic present of the CGG/MoS2 interface was recorded utilizing a soluble Fe(CN)6-3/-4 redox probe by differential pulse voltammetry (DPV). The dynamic vary for the detection of prehybridized duplexes ranged from 1 aM to 100 nM with a 3.Zero aM restrict of detection.

A detection vary of 100 fM to 1 nM was recorded for floor hybridization occasions. Utilizing this technique, we have been in a position to observe selectivity of MoS2 for CGG repeats and distinguish nonpathogenic from disease-associated repeat lengths. The detection of CGG repeat sequences on inkjet printable 2D MoS2 surfaces is a ahead step towards creating chip-based fast and label-free sensors for the detection of repeat enlargement sequences. We skilled and evaluated the fashions on a dataset that was generated in a earlier examine which investigated fabrication of porous polymer scaffolds by way of extrusion-based 3D printing with a full-factorial design. Our outcomes present that each fashions have been in a position to accurately label nearly all of the examined configurations whereas a less complicated linear ML mannequin was not efficient. Moreover our evaluation confirmed {that a} full factorial design for information assortment can result in redundancies within the information, within the context of ML, and we suggest a extra environment friendly information assortment technique.

 

Hybrid Sensor Machine for Simultaneous Floor Plasmon Resonance and Floor Acoustic Wave Measurements

Floor plasmon resonance (SPR) and Love wave (LW) floor acoustic wave (SAW) sensors have been established as dependable biosensing applied sciences for label-free, real-time monitoring of biomolecular interactions. This work experiences the event of a mixed SPR/LW-SAW platform to facilitate simultaneous optical and acoustic measurements for the investigation of biomolecules binding on a single floor. The system’s output gives recordings of two acoustic parameters, part and amplitude of a Love wave, synchronized with SPR readings.
We current the design and manufacturing of a novel experimental set-up using, along with the SPR/LW-SAW machine, a 3D-printed plastic holder mixed with a PDMS microfluidic cell in order that the platform can be utilized in a flow-through mode. The system was evaluated in a scientific examine of the optical and acoustic responses for various floor perturbations, i.e., inflexible mass loading (Au deposition), pure viscous loading (glycerol and sucrose options) and protein adsorption (BSA). Our outcomes present the theoretical and experimental foundation for future utility of the mixed system to different biochemical and biophysical research.
 Label-free Electrochemical Detection of CGG Repeats on Inkjet Printable 2D Layers of MoS 2
Label-free Electrochemical Detection of CGG Repeats on Inkjet Printable 2D Layers of MoS 2

Photoluminescent and Chromic Nanomaterials for Anticounterfeiting Applied sciences: Latest Advances and Future Challenges

Counterfeiting and inverse engineering of safety and confidential paperwork, equivalent to banknotes, passports, nationwide playing cards, certificates, and helpful merchandise, has considerably been elevated, which is a significant problem for governments, firms, and clients. From latest world experiences printed in 2017, the counterfeiting market was evaluated to be $107.26 billion in 2016 and forecasted to succeed in $206.57 billion by 2021 at a compound annual development fee of 14.0%. Growth of anticounterfeiting and authentication applied sciences with multilevel securities is a robust resolution to beat this problem.
Stimuli-chromic (photochromic, hydrochromic, and thermochromic) and photoluminescent (fluorescent and phosphorescent) compounds are essentially the most vital and relevant supplies for growth of complicated anticounterfeiting inks with a high-security stage and quick authentication. Extremely environment friendly anticounterfeiting and authentication applied sciences have been developed to succeed in excessive safety and effectivity. Relevant supplies for anticounterfeiting functions are usually based mostly on photochromic and photoluminescent compounds, for which hydrochromic and thermochromic supplies have extensively been utilized in latest many years.
A variety of supplies, equivalent to natural and inorganic metallic complexes, polymer nanoparticles, quantum dots, polymer dots, carbon dots, upconverting nanoparticles, and supramolecular buildings, may show all of those phenomena relying on their bodily and chemical traits. The polymeric anticounterfeiting inks have just lately obtained vital consideration due to their excessive stability for printing on confidential paperwork.

INK-128

9527-5
EUR 185

Holder for Plasmid Midi, Maxi and Maxi plus, Ion Exchange column

FAPDE-holder-for-ion-exchange 1 prep
EUR 158

p15 INK antibody

70R-30703 100 ug
EUR 327
Description: Rabbit polyclonal p15 INK antibody

p18 INK antibody

70R-30704 100 ug
EUR 327
Description: Rabbit polyclonal p18 INK antibody

p15 INK Antibody

33457-100ul 100ul
EUR 252

p15 INK Antibody

33457-50ul 50ul
EUR 187

p18 INK Antibody

33458-100ul 100ul
EUR 252

p18 INK Antibody

33458-50ul 50ul
EUR 187

Ink 128 (Mln0128)

20-abx186471
  • EUR 1901.00
  • EUR 509.00
  • 100 mg
  • 10 mg
  • Shipped within 1-2 weeks.

p16 INK Antibody

20-abx119396
  • EUR 314.00
  • EUR 98.00
  • EUR 398.00
  • EUR 495.00
  • 100 ug
  • 10 ug
  • 200 ug
  • 300 µg
  • Shipped within 5-10 working days.

p15 INK Antibody

20-abx013163
  • EUR 314.00
  • EUR 98.00
  • EUR 398.00
  • EUR 495.00
  • 100 ug
  • 10 ug
  • 200 ug
  • 300 µg
  • Shipped within 5-10 working days.

p18 INK Antibody

20-abx013164
  • EUR 314.00
  • EUR 98.00
  • EUR 398.00
  • EUR 495.00
  • 100 ug
  • 10 ug
  • 200 ug
  • 300 µg
  • Shipped within 5-10 working days.

p16 INK Antibody

AF0228 200ul
EUR 304
Description: p16 INK antibody detects endogenous levels of total p16 INK.

p15 INK Antibody

AF0230 200ul
EUR 304
Description: p15 INK antibody detects endogenous levels of total p15 INK.

p18 INK Antibody

AF0620 200ul
EUR 304
Description: p18 INK Antibody detects endogenous levels of p18 INK.

p18 INK Antibody

AF5356 200ul
EUR 304
Description: p18 INK Antibody detects endogenous levels of total p18 INK.

p16 INK Antibody

AF5484 200ul
EUR 304
Description: p16 INK Antibody detects endogenous levels of total p16 INK.

p15 INK Antibody

AF5486 200ul
EUR 304
Description: p15 INK Antibody detects endogenous levels of total p15 INK.

p18 INK Antibody

ABF5356 100 ug
EUR 438

p16 INK Antibody

ABF5484 100 ug
EUR 438

p15 INK Antibody

ABF5486 100 ug
EUR 438

p16 INK Antibody

ABF0228 100 ug
EUR 438

p15 INK Antibody

ABF0230 100 ug
EUR 438

p18 INK Antibody

ABF0620 100 ug
EUR 438

INK 128 (MLN0128)

A8551-10 10 mg
EUR 166
Description: INK 128 (MLN0128) is a selective inhibitor of mTOR with IC50 value of 1 nM [3].mTOR is an evolutionarily conserved serine/threonine kinase which combined PI3K/AKT/mTOR pathway and plays an important role in regulating many fundamental features of cell growth and division [1].

INK 128 (MLN0128)

A8551-5 5 mg
EUR 142
Description: INK 128 (MLN0128) is a selective inhibitor of mTOR with IC50 value of 1 nM [3].mTOR is an evolutionarily conserved serine/threonine kinase which combined PI3K/AKT/mTOR pathway and plays an important role in regulating many fundamental features of cell growth and division [1].

INK 128 (MLN0128)

A8551-5.1 10 mM (in 1mL DMSO)
EUR 154
Description: INK 128 (MLN0128) is a selective inhibitor of mTOR with IC50 value of 1 nM [3].mTOR is an evolutionarily conserved serine/threonine kinase which combined PI3K/AKT/mTOR pathway and plays an important role in regulating many fundamental features of cell growth and division [1].

INK 128 (MLN0128)

A8551-50 50 mg
EUR 340
Description: INK 128 (MLN0128) is a selective inhibitor of mTOR with IC50 value of 1 nM [3].mTOR is an evolutionarily conserved serine/threonine kinase which combined PI3K/AKT/mTOR pathway and plays an important role in regulating many fundamental features of cell growth and division [1].

Anti-p15 INK Antibody

A01500-1 100ul
EUR 397
Description: Rabbit Polyclonal p15 INK Antibody. Validated in IF, IHC, WB and tested in Human, Mouse, Rat.

Anti-p18 INK Antibody

A03299 100ul
EUR 397
Description: Rabbit Polyclonal p18 INK Antibody. Validated in IHC, WB and tested in Human, Mouse, Rat.

p16 INK Blocking Peptide

AF0228-BP 1mg
EUR 195

p15 INK Blocking Peptide

AF0230-BP 1mg
EUR 195

p18 INK Blocking Peptide

AF0620-BP 1mg
EUR 195

p18 INK Blocking Peptide

AF5356-BP 1mg
EUR 195

p16 INK Blocking Peptide

AF5484-BP 1mg
EUR 195

p15 INK Blocking Peptide

AF5486-BP 1mg
EUR 195

p15 INK Conjugated Antibody

C33457 100ul
EUR 397

p18 INK Conjugated Antibody

C33458 100ul
EUR 397

India Ink Stain Solution

PW006 100ml
EUR 74.36
  • Product category: Biochemicals/Indicators/Stains/Peptide/Protein Related

p16 INK Cell ELISA Kit

abx595438-96tests 96 tests
EUR 637
  • Shipped within 1-2 weeks.

p16 INK recombinant monoclonal antibody

A5869 100ul X 3
EUR 595
  • Comparisons between Mnoclonal, Polyclonal and Recombinant antibodies and their benefits: Regular monoclonal antibodies have higher purity, better specificity and less lot-to-lot variations than polyclonal antibodies. Recombinant antibodies, however,
  • Show more
Description: A recombinant monoclonal antibody from rabbit against human p16 INK for WB, IF,ELISA

Anti-p16 INK Monoclonal Antibody

M00016 100ug
EUR 397
Description: Rabbit Monoclonal p16 INK Antibody. Validated in Flow Cytometry, IP, IF, IHC, ICC, WB and tested in Human.

p16 INK Colorimetric Cell-Based ELISA Kit

EKC1417 100ul
EUR 572

p5 Ligand for Dnak and and DnaJ

5-01680 4 x 5mg Ask for price

p16 INK Colorimetric Cell-Based ELISA Kit (OKAG00927)

OKAG00927 96 Wells
EUR 596
Description: Description of target: ;Species reactivity: Human, Mouse;Application: ELISA;Assay info: Assay Type: Cell-Based
Subtype: None
Detection Method: Colorimetric 450 nm;Sensitivity:

p5 Ligand for Dnak and and DnaJ Peptide

20-abx266082
  • EUR 411.00
  • EUR 662.00
  • EUR 314.00
  • 10 mg
  • 25 mg
  • 5 mg
  • Shipped within 5-10 working days.

Blocking Buffer for ICC and IHC

SF40011 10 ml
EUR 128

Permeabilization Buffer for ICC and IHC

SF40012 10 ml
EUR 122

Monoclonal antibody for SUR1 and SUR2B

SMC-432D 0.1mg
EUR 353
  • Sulfonylurea receptors (SUR) are membrane proteins which are the molecular targets of the sulfonylurea class of anti-diabetic drugs whose mechanism of action is to promote insulin release from pancreatic beta cells. More specifically, SUR proteins ar
  • Show more
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated.

Monoclonal antibody for SUR1 and SUR2B

SMC-432D-A390 0.1mg
EUR 400
  • Sulfonylurea receptors (SUR) are membrane proteins which are the molecular targets of the sulfonylurea class of anti-diabetic drugs whose mechanism of action is to promote insulin release from pancreatic beta cells. More specifically, SUR proteins ar
  • Show more
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 390.

Monoclonal antibody for SUR1 and SUR2B

SMC-432D-A488 0.1mg
EUR 399
  • Sulfonylurea receptors (SUR) are membrane proteins which are the molecular targets of the sulfonylurea class of anti-diabetic drugs whose mechanism of action is to promote insulin release from pancreatic beta cells. More specifically, SUR proteins ar
  • Show more
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 488.

Monoclonal antibody for SUR1 and SUR2B

SMC-432D-A565 0.1mg
EUR 399
  • Sulfonylurea receptors (SUR) are membrane proteins which are the molecular targets of the sulfonylurea class of anti-diabetic drugs whose mechanism of action is to promote insulin release from pancreatic beta cells. More specifically, SUR proteins ar
  • Show more
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 565.

Monoclonal antibody for SUR1 and SUR2B

SMC-432D-A594 0.1mg
EUR 399
  • Sulfonylurea receptors (SUR) are membrane proteins which are the molecular targets of the sulfonylurea class of anti-diabetic drugs whose mechanism of action is to promote insulin release from pancreatic beta cells. More specifically, SUR proteins ar
  • Show more
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 594.

Monoclonal antibody for SUR1 and SUR2B

SMC-432D-A633 0.1mg
EUR 399
  • Sulfonylurea receptors (SUR) are membrane proteins which are the molecular targets of the sulfonylurea class of anti-diabetic drugs whose mechanism of action is to promote insulin release from pancreatic beta cells. More specifically, SUR proteins ar
  • Show more
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 633.

Monoclonal antibody for SUR1 and SUR2B

SMC-432D-A655 0.1mg
EUR 399
  • Sulfonylurea receptors (SUR) are membrane proteins which are the molecular targets of the sulfonylurea class of anti-diabetic drugs whose mechanism of action is to promote insulin release from pancreatic beta cells. More specifically, SUR proteins ar
  • Show more
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 655.

Monoclonal antibody for SUR1 and SUR2B

SMC-432D-A680 0.1mg
EUR 399
  • Sulfonylurea receptors (SUR) are membrane proteins which are the molecular targets of the sulfonylurea class of anti-diabetic drugs whose mechanism of action is to promote insulin release from pancreatic beta cells. More specifically, SUR proteins ar
  • Show more
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 680.

Monoclonal antibody for SUR1 and SUR2B

SMC-432D-A700 0.1mg
EUR 399
  • Sulfonylurea receptors (SUR) are membrane proteins which are the molecular targets of the sulfonylurea class of anti-diabetic drugs whose mechanism of action is to promote insulin release from pancreatic beta cells. More specifically, SUR proteins ar
  • Show more
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 700.

Monoclonal antibody for SUR1 and SUR2B

SMC-432D-ALP 0.1mg
EUR 393
  • Sulfonylurea receptors (SUR) are membrane proteins which are the molecular targets of the sulfonylurea class of anti-diabetic drugs whose mechanism of action is to promote insulin release from pancreatic beta cells. More specifically, SUR proteins ar
  • Show more
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Alkaline Phosphatase.

Monoclonal antibody for SUR1 and SUR2B

SMC-432D-APC 0.1mg
EUR 398
  • Sulfonylurea receptors (SUR) are membrane proteins which are the molecular targets of the sulfonylurea class of anti-diabetic drugs whose mechanism of action is to promote insulin release from pancreatic beta cells. More specifically, SUR proteins ar
  • Show more
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC.

Monoclonal antibody for SUR1 and SUR2B

SMC-432D-APCCY7 0.1mg
EUR 470
  • Sulfonylurea receptors (SUR) are membrane proteins which are the molecular targets of the sulfonylurea class of anti-diabetic drugs whose mechanism of action is to promote insulin release from pancreatic beta cells. More specifically, SUR proteins ar
  • Show more
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC/Cy7.

Monoclonal antibody for SUR1 and SUR2B

SMC-432D-BI 0.1mg
EUR 395
  • Sulfonylurea receptors (SUR) are membrane proteins which are the molecular targets of the sulfonylurea class of anti-diabetic drugs whose mechanism of action is to promote insulin release from pancreatic beta cells. More specifically, SUR proteins ar
  • Show more
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Biotin.

Monoclonal antibody for SUR1 and SUR2B

SMC-432D-DY350 0.1mg
EUR 413
  • Sulfonylurea receptors (SUR) are membrane proteins which are the molecular targets of the sulfonylurea class of anti-diabetic drugs whose mechanism of action is to promote insulin release from pancreatic beta cells. More specifically, SUR proteins ar
  • Show more
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 350.

Monoclonal antibody for SUR1 and SUR2B

SMC-432D-DY405 0.1mg
EUR 402
  • Sulfonylurea receptors (SUR) are membrane proteins which are the molecular targets of the sulfonylurea class of anti-diabetic drugs whose mechanism of action is to promote insulin release from pancreatic beta cells. More specifically, SUR proteins ar
  • Show more
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 405.

Monoclonal antibody for SUR1 and SUR2B

SMC-432D-DY488 0.1mg
EUR 392
  • Sulfonylurea receptors (SUR) are membrane proteins which are the molecular targets of the sulfonylurea class of anti-diabetic drugs whose mechanism of action is to promote insulin release from pancreatic beta cells. More specifically, SUR proteins ar
  • Show more
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 488.

Monoclonal antibody for SUR1 and SUR2B

SMC-432D-DY594 0.1mg
EUR 394
  • Sulfonylurea receptors (SUR) are membrane proteins which are the molecular targets of the sulfonylurea class of anti-diabetic drugs whose mechanism of action is to promote insulin release from pancreatic beta cells. More specifically, SUR proteins ar
  • Show more
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 594.

Monoclonal antibody for SUR1 and SUR2B

SMC-432D-DY633 0.1mg
EUR 389
  • Sulfonylurea receptors (SUR) are membrane proteins which are the molecular targets of the sulfonylurea class of anti-diabetic drugs whose mechanism of action is to promote insulin release from pancreatic beta cells. More specifically, SUR proteins ar
  • Show more
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 633.

Monoclonal antibody for SUR1 and SUR2B

SMC-432D-FITC 0.1mg
EUR 391
  • Sulfonylurea receptors (SUR) are membrane proteins which are the molecular targets of the sulfonylurea class of anti-diabetic drugs whose mechanism of action is to promote insulin release from pancreatic beta cells. More specifically, SUR proteins ar
  • Show more
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with FITC.

Monoclonal antibody for SUR1 and SUR2B

SMC-432D-HRP 0.1mg
EUR 387
  • Sulfonylurea receptors (SUR) are membrane proteins which are the molecular targets of the sulfonylurea class of anti-diabetic drugs whose mechanism of action is to promote insulin release from pancreatic beta cells. More specifically, SUR proteins ar
  • Show more
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with HRP.

Monoclonal antibody for SUR1 and SUR2B

SMC-432D-P594 0.1mg
EUR 406
  • Sulfonylurea receptors (SUR) are membrane proteins which are the molecular targets of the sulfonylurea class of anti-diabetic drugs whose mechanism of action is to promote insulin release from pancreatic beta cells. More specifically, SUR proteins ar
  • Show more
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with PE/ATTO 594.

Monoclonal antibody for SUR1 and SUR2B

SMC-432D-PCP 0.1mg
EUR 398
  • Sulfonylurea receptors (SUR) are membrane proteins which are the molecular targets of the sulfonylurea class of anti-diabetic drugs whose mechanism of action is to promote insulin release from pancreatic beta cells. More specifically, SUR proteins ar
  • Show more
Description: A monoclonal antibody from clone S323A-31 against Human SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with PerCP.

Monoclonal antibody for SUR1 and SUR2B

SMC-432D-RPE 0.1mg
EUR 396
  • Sulfonylurea receptors (SUR) are membrane proteins which are the molecular targets of the sulfonylurea class of anti-diabetic drugs whose mechanism of action is to promote insulin release from pancreatic beta cells. More specifically, SUR proteins ar
  • Show more
Description: A monoclonal antibody from clone S323A-31 against Human SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with RPE.

Monoclonal antibody for SUR1 and SUR2B

SMC-432D-STR 0.1mg
EUR 397
  • Sulfonylurea receptors (SUR) are membrane proteins which are the molecular targets of the sulfonylurea class of anti-diabetic drugs whose mechanism of action is to promote insulin release from pancreatic beta cells. More specifically, SUR proteins ar
  • Show more
Description: A monoclonal antibody from clone S323A-31 against Human SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Streptavidin.

Monoclonal antibody for SUR1 and SUR2B

SMC-432S 0.012mg
EUR 65
  • Sulfonylurea receptors (SUR) are membrane proteins which are the molecular targets of the sulfonylurea class of anti-diabetic drugs whose mechanism of action is to promote insulin release from pancreatic beta cells. More specifically, SUR proteins ar
  • Show more
Description: A monoclonal antibody from clone S323A-31 against Human SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated.

ELISA kit for Mouse Dual adapter for phosphotyrosine and 3-phosphotyrosine and 3-phosphoinositide (DAPP1)

KTE71336-48T 48T
EUR 332
  • DAPP1 (Dual Adaptor Of Phosphotyrosine And 3-Phosphoinositides 1) is a Protein Coding gene. Among its related pathways are B cell receptor signaling pathway (KEGG) and Immune System. GO annotations related to this gene include phospholipid binding an
  • Show more
Description: Quantitative sandwich ELISA for measuring Mouse Dual adapter for phosphotyrosine and 3-phosphotyrosine and 3-phosphoinositide (DAPP1) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Mouse Dual adapter for phosphotyrosine and 3-phosphotyrosine and 3-phosphoinositide (DAPP1)

KTE71336-5platesof96wells 5 plates of 96 wells
EUR 2115
  • DAPP1 (Dual Adaptor Of Phosphotyrosine And 3-Phosphoinositides 1) is a Protein Coding gene. Among its related pathways are B cell receptor signaling pathway (KEGG) and Immune System. GO annotations related to this gene include phospholipid binding an
  • Show more
Description: Quantitative sandwich ELISA for measuring Mouse Dual adapter for phosphotyrosine and 3-phosphotyrosine and 3-phosphoinositide (DAPP1) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Mouse Dual adapter for phosphotyrosine and 3-phosphotyrosine and 3-phosphoinositide (DAPP1)

KTE71336-96T 96T
EUR 539
  • DAPP1 (Dual Adaptor Of Phosphotyrosine And 3-Phosphoinositides 1) is a Protein Coding gene. Among its related pathways are B cell receptor signaling pathway (KEGG) and Immune System. GO annotations related to this gene include phospholipid binding an
  • Show more
Description: Quantitative sandwich ELISA for measuring Mouse Dual adapter for phosphotyrosine and 3-phosphotyrosine and 3-phosphoinositide (DAPP1) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Human Dual adapter for phosphotyrosine and 3-phosphotyrosine and 3-phosphoinositide (DAPP1)

KTE62145-48T 48T
EUR 332
  • Dual adapter for phosphotyrosine and 3-phosphotyrosine and 3-phosphoinositide is a protein that in humans is encoded by the DAPP1 gene.
Description: Quantitative sandwich ELISA for measuring Human Dual adapter for phosphotyrosine and 3-phosphotyrosine and 3-phosphoinositide (DAPP1) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Human Dual adapter for phosphotyrosine and 3-phosphotyrosine and 3-phosphoinositide (DAPP1)

KTE62145-5platesof96wells 5 plates of 96 wells
EUR 2115
  • Dual adapter for phosphotyrosine and 3-phosphotyrosine and 3-phosphoinositide is a protein that in humans is encoded by the DAPP1 gene.
Description: Quantitative sandwich ELISA for measuring Human Dual adapter for phosphotyrosine and 3-phosphotyrosine and 3-phosphoinositide (DAPP1) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Human Dual adapter for phosphotyrosine and 3-phosphotyrosine and 3-phosphoinositide (DAPP1)

KTE62145-96T 96T
EUR 539
  • Dual adapter for phosphotyrosine and 3-phosphotyrosine and 3-phosphoinositide is a protein that in humans is encoded by the DAPP1 gene.
Description: Quantitative sandwich ELISA for measuring Human Dual adapter for phosphotyrosine and 3-phosphotyrosine and 3-phosphoinositide (DAPP1) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ExoQuick Exosome Isolation and RNA Purification kit (for Serum and Plasma)

EQ806A-1 20 preps
EUR 554

XCF COMPLETE Exosome and cfDNA Isolation Kit (for Serum and Plasma)

XCF100A-1 20 rxn
EUR 647
  • Category: Exosome

Sample, Antibody and Conjugate Diluent (20X) for ELISA (For serum, plasma sample conservation and low background)

80066 50 ml
EUR 232

Cell Lysis Buffer for WB and IP

abx090622-100ml 100 ml
EUR 217
  • Shipped within 5-10 working days.

Protein Extraction for Fixed and Embedded Tissues

P525-20 NULL
EUR 0

Antibody Dilution Buffer for ICC and IHC

SF40010 10 ml
EUR 122

Tips, 5ml for Propette and Propette LE

P4305 250/pack
EUR 82.4
Description: Tips 5ml for Propette and Propette LE

Dual Adapter For Phosphotyrosine And 3-Phosphotyrosine And 3-Phosphoinositide (DAPP1) Antibody

abx224298-100ug 100 ug
EUR 411
  • Shipped within 5-10 working days.

Immuno Diluent and Block (Clear), 125 ml; For diluting and storing antibodies

NB307-C 125 ml
EUR 380

Antibody and Conjugate Diluent for ELISA concentrate (10X)

80070 50 ml
EUR 202

ELISA kit for Human Coxsackievirus and adenovirus receptor

EK3312 96 tests
EUR 553
Description: Enzyme-linked immunosorbent assay kit for quantification of Human Coxsackievirus and adenovirus receptor in samples from serum, plasma, tissue homogenates and other biological fluids.

Mitochondria Isolation Kit for Tissue and Cultured Cells

KC010100 1 kit
EUR 320
Description: Can be used for various proteomics studies in both normal and pathological cases. It is an excellent control and suitable for educational purposes. This product is prepared from whole tissue homogenates and has undergone SDS-PAGE quality control analysis. The protein is stored in a buffer with protease inhibitor cocktail fo prevent degradation.

Nuclei and Cytosol Isolation Kit for Adipose Tissues

P529 NULL
EUR 0

Miniprep Kit For Plasmid DNA Extraction And Purification

MB1005-100Reactions 100 Reactions
EUR 143

Miniprep Kit For Plasmid DNA Extraction And Purification

MB1005-250Reactions 250 Reactions
EUR 259

Miniprep Kit For Plasmid DNA Extraction And Purification

MB1005-50Reactions 50 Reactions
EUR 120

Rat Creatine kinase for muscle and brain (CKMB)

QY-E11888 96T
EUR 374

DNA Loading (6X) Buffer for Agarose and Acrylamide Gels

306-205 5x1 ml
EUR 47

OPTIONAL HEAD FOR 8X15ML AND 8X12/13MM DIAMETER TUBES

480103 1/pk
EUR 63
Description: Lab Equipment; Shakers & Mixers

SPRING LOADED PLATFORM FOR FLASKS, BOTTLES AND TUBE RACKS

48012 1/pk
EUR 219
Description: Lab Equipment; Shakers & Mixers

ELISA kit for Rat PTEN (Phosphatase and Tensin Homolog)

E-EL-R0645 1 plate of 96 wells
EUR 534
  • Gentaur's PTEN ELISA kit utilizes the Sandwich-ELISA principle. The micro ELISA plate provided in this kit has been pre-coated with an antibody specific to Rat PTEN. Standards or samples are added to the micro ELISA plate wells and combined with the
  • Show more
Description: A sandwich ELISA kit for quantitative measurement of Rat PTEN (Phosphatase and Tensin Homolog) in samples from Serum, Plasma, Cell supernatant

ELISA kit for Human PC4 and SFRS1-interacting protein

EK3586 96 tests
EUR 670
Description: Enzyme-linked immunosorbent assay kit for quantification of Human PC4 and SFRS1-interacting protein in samples from serum, plasma, tissue homogenates and other biological fluids.

ELISA kit for Rat PTEN (Phosphatase And Tensin Homolog)

ELK4264 1 plate of 96 wells
EUR 432
  • The microtiter plate provided in this kit has been pre-coated with an antibody specific to Phosphatase And Tensin Homolog (PTEN). Standards or samples are then added to the appropriate microtiter plate wells with a biotin-conjugated antibody specific
  • Show more
Description: A sandwich ELISA kit for detection of Phosphatase And Tensin Homolog from Rat in samples from blood, serum, plasma, cell culture fluid and other biological fluids.

ELISA kit for Human PTEN (Phosphatase And Tensin Homolog)

ELK1367 1 plate of 96 wells
EUR 372
  • The microtiter plate provided in this kit has been pre-coated with an antibody specific to Phosphatase And Tensin Homolog (PTEN). Standards or samples are then added to the appropriate microtiter plate wells with a biotin-conjugated antibody specific
  • Show more
Description: A sandwich ELISA kit for detection of Phosphatase And Tensin Homolog from Human in samples from blood, serum, plasma, cell culture fluid and other biological fluids.

ELISA kit for Mouse PTEN (Phosphatase And Tensin Homolog)

ELK1368 1 plate of 96 wells
EUR 372
  • The microtiter plate provided in this kit has been pre-coated with an antibody specific to Phosphatase And Tensin Homolog (PTEN). Standards or samples are then added to the appropriate microtiter plate wells with a biotin-conjugated antibody specific
  • Show more
Description: A sandwich ELISA kit for detection of Phosphatase And Tensin Homolog from Mouse in samples from blood, serum, plasma, cell culture fluid and other biological fluids.

ELISA kit for Mouse KIBRA (Kidney And Brain Protein)

ELK8022 1 plate of 96 wells
EUR 432
  • The microtiter plate provided in this kit has been pre-coated with an antibody specific to Kidney And Brain Protein (KIBRA). Standards or samples are then added to the appropriate microtiter plate wells with a biotin-conjugated antibody specific to K
  • Show more
Description: A sandwich ELISA kit for detection of Kidney And Brain Protein from Mouse in samples from blood, serum, plasma, cell culture fluid and other biological fluids.

Orcein Stain Kit (For Hepatitis B and Elastic Fibers)

HBK-1 1 kit(s)
EUR 239

Orcein Stain Kit (For Hepatitis B and Elastic Fibers)

HBK-2 1 kit(s)
EUR 144

ExoQuick PLUS Exosome Purification Kit - for serum and plasma

EQPL10A-1 10 reactions
EUR 579
  • Category: Exosomes

ExoQuick ULTRA EV Isolation Kit for Serum and Plasma

EQULTRA-20A-1 20 reactions
EUR 579

GEL CARRYING TRAY FOR GD-1000 AND GDBL-1000

GD-GCT 1/pk
EUR 207
Description: Lab Equipment; Axygen Branded EQ

Fontana-Masson Stain Kit (For Argentaffin Cells and Melanin)

FMS-1 1 kit(s)
EUR 216

Fontana-Masson Stain Kit (For Argentaffin Cells and Melanin)

FMS-2 1 kit(s)
EUR 133

ELISA kit for Human Phosphatase and tensin homolog (PTEN)

KTE62888-48T 48T
EUR 354
Description: Quantitative sandwich ELISA for measuring Human Phosphatase and tensin homolog (PTEN) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Human Phosphatase and tensin homolog (PTEN)

KTE62888-5platesof96wells 5 plates of 96 wells
EUR 2252
Description: Quantitative sandwich ELISA for measuring Human Phosphatase and tensin homolog (PTEN) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Human Phosphatase and tensin homolog (PTEN)

KTE62888-96T 96T
EUR 572
Description: Quantitative sandwich ELISA for measuring Human Phosphatase and tensin homolog (PTEN) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

Protein Extraction Kit for Hair, Nail, Wool and Horn

P521-20 NULL
EUR 0

Protein Extraction Kit for Hair, Nail, Wool and Horn

P521-4 NULL
EUR 0

Protein Extraction Kit for Hair, Nail, Wool and Horn

P521-80 NULL
EUR 0

Albumin Depletion Reagent for Plasma and Serum (20 ml)

P5W13 NULL
EUR 0

pGreenPuro Scramble Hairpin Control - Construct (for shRNAs and miRZips)

MZIP000-AA-1 Miniprep DNA
EUR 684
  • Category: MicroRNA Tools

pGreenPuro Scramble Hairpin Control - Construct (for shRNAs and miRZips)

MZIP000-PA-1 Bacterial Streak
EUR 656
  • Category: MicroRNA Tools

pGreenPuro Scramble Hairpin Control - Virus (for shRNAs and miRZips)

MZIP000-VA-1 >1 x 10^6 IFUs
EUR 716
  • Category: MicroRNA Tools

for Ring1 And YY1 Binding Protein (RYBP)ELISA kit

SEK063Hu-10x96wellstestplate 10x96-wells test plate
EUR 4731.5
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of for Ring1 And YY1 Binding Protein (RYBP) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Assay: C
  • Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of for Ring1 And YY1 Binding Protein (RYBP) in Tissue homogenates, cell lysates and other biological fluids.

for Ring1 And YY1 Binding Protein (RYBP)ELISA kit

SEK063Hu-1x48wellstestplate 1x48-wells test plate
EUR 477.3
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of for Ring1 And YY1 Binding Protein (RYBP) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Assay: C
  • Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of for Ring1 And YY1 Binding Protein (RYBP) in Tissue homogenates, cell lysates and other biological fluids.

for Ring1 And YY1 Binding Protein (RYBP)ELISA kit

SEK063Hu-1x96wellstestplate 1x96-wells test plate
EUR 639
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of for Ring1 And YY1 Binding Protein (RYBP) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Assay: C
  • Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of for Ring1 And YY1 Binding Protein (RYBP) in Tissue homogenates, cell lysates and other biological fluids.

for Ring1 And YY1 Binding Protein (RYBP)ELISA kit

SEK063Hu-5x96wellstestplate 5x96-wells test plate
EUR 2575.5
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of for Ring1 And YY1 Binding Protein (RYBP) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Assay: C
  • Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of for Ring1 And YY1 Binding Protein (RYBP) in Tissue homogenates, cell lysates and other biological fluids.

ELISA Kit for Ring1 And YY1 Binding Protein (RYBP)

4-SEK063Hu
  • EUR 4782.00
  • EUR 2526.00
  • EUR 640.00
  • 10 plates of 96 wells
  • 5 plates of 96 wells
  • 1 plate of 96 wells
  • Known also as Ring1 And YY1 Binding Protein elisa. Alternative names of the recognized antigen: AAP1
  • DEDAF
  • YEAF1
  • APAP-1
  • Apoptin-associating protein 1
  • YY1 And E4TF1 Associated Factor 1
  • Apoptin-Associating Protein 1
  • Death Effector Domain-Associa
  • Show more
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Ring1 And YY1 Binding Protein (RYBP) in samples from Tissue homogenates, cell lysates and other biological fluids with no significant corss-reactivity with analogues from other species.

Serial Printer for Accuris Series Dx and Tx balances

W3130 1 PC
EUR 560.03
  • To order instruments in 115V / US plug please delete the 'E' off the order code.European 2 pin plugs will be supplied as standard, please request UK if required.

Clamp universal platform for flasks and tube racks (11x9.5in)

BCM1623 1 pcs, 1 UNIT
EUR 371.15
  • Product category: Benchtop Equipment/Mixers/Shakers

CoolCaddy cold station for PCR plate, tubes, and cryos

R4015 1/pack
EUR 143.83
Description: CoolCaddy cold station for PCR plate tubes

Mouse Serum IgG3 detection and titration and titration ELISA kit, Qualitative (sufficient for 500-1000 tests)

80150-G3 1 kit
EUR 651

Mouse Serum IgM detection and titration and titration ELISA kit, Qualitative (sufficient for 500-1000 tests)

80150-M 1 kit
EUR 651

Rat Serum IgG detection and titration and titration ELISA kit, Qualitative (sufficient for 500-1000 tests)

80155-G 1 kit
EUR 651

Rat Serum IgM detection and titration and titration ELISA kit, Qualitative (sufficient for 500-1000 tests)

80155-M 1 kit
EUR 651

Immuno Diluent and Block (Green Color Indicator), 125 ml; For diluting and indefinate storage of antibodies

NB307 125 ml
EUR 380

Azide-free ImmunoDiluent for diluting and storing antibody conjugates and enzymes sensative to sodium azide, 60ml

NB365-60 60 ml
EUR 369

Viability/Cytotoxicity Assay kit for Bacteria Live and Dead Cells

30027 1KIT
EUR 356
Description: Minimum order quantity: 1 unit of 1KIT

OPTIONAL HEAD FOR 24X1.5/2.0ML TUBES,24X0.5ML TUBES AND 32X0.2ML

480101 1/pk
EUR 57
Description: Lab Equipment; Shakers & Mixers
As well as, the printing applied sciences together with hand-writing, stamping, inkjet printing, display printing, and anticounterfeiting labels are mentioned for introduction of essentially the most environment friendly strategies for utility of various anticounterfeiting inks. This overview would assist scientists to design and develop essentially the most relevant encryption, authentication, and anticounterfeiting applied sciences with excessive safety, quick detection, and potential functions in safety marking and data encryption on numerous substrates.

Leave A Comment