Label-free Electrochemical Detection of CGG Repeats on Inkjet Printable 2D Layers of MoS 2

Label-free Electrochemical Detection of CGG Repeats on Inkjet Printable 2D Layers of MoS 2

Versatile and ultrasensitive biosensing platforms able to detecting a lot of trinucleotide repeats (TNRs) are essential for future know-how growth wanted to fight quite a lot of genetic issues. For instance, trinucleotide CGG repeat expansions within the FMR1 gene could cause Fragile X syndrome (FXS) and Fragile X-associated tremor/ataxia syndrome (FXTAS). Present state-of-the-art applied sciences to detect repeat sequences are costly, whereas counting on difficult procedures, and susceptible to false negatives. We reasoned that two-dimensional (2D) molybdenum sulfide (MoS2) surfaces could also be helpful for label-free electrochemical detection of CGG repeats because of its excessive affinity for guanine bases.

Right here, we developed a low-cost and delicate wax-on-plastic electrochemical sensor utilizing 2D MoS2 ink for the detection of CGG repeats. The ink containing few-layered MoS2 nanosheets was ready and characterised utilizing optical, electrical, electrochemical, and electron microscopic strategies. The units have been characterised by electron microscopic and electrochemical strategies. Repetitive CGG DNA was adsorbed on a MoS2 floor in a excessive cationic power atmosphere and the electrocatalytic present of the CGG/MoS2 interface was recorded utilizing a soluble Fe(CN)6-3/-4 redox probe by differential pulse voltammetry (DPV). The dynamic vary for the detection of prehybridized duplexes ranged from 1 aM to 100 nM with a 3.Zero aM restrict of detection.

A detection vary of 100 fM to 1 nM was recorded for floor hybridization occasions. Utilizing this technique, we have been in a position to observe selectivity of MoS2 for CGG repeats and distinguish nonpathogenic from disease-associated repeat lengths. The detection of CGG repeat sequences on inkjet printable 2D MoS2 surfaces is a ahead step towards creating chip-based fast and label-free sensors for the detection of repeat enlargement sequences. We skilled and evaluated the fashions on a dataset that was generated in a earlier examine which investigated fabrication of porous polymer scaffolds by way of extrusion-based 3D printing with a full-factorial design. Our outcomes present that each fashions have been in a position to accurately label nearly all of the examined configurations whereas a less complicated linear ML mannequin was not efficient. Moreover our evaluation confirmed {that a} full factorial design for information assortment can result in redundancies within the information, within the context of ML, and we suggest a extra environment friendly information assortment technique.

 

Hybrid Sensor Machine for Simultaneous Floor Plasmon Resonance and Floor Acoustic Wave Measurements

Floor plasmon resonance (SPR) and Love wave (LW) floor acoustic wave (SAW) sensors have been established as dependable biosensing applied sciences for label-free, real-time monitoring of biomolecular interactions. This work experiences the event of a mixed SPR/LW-SAW platform to facilitate simultaneous optical and acoustic measurements for the investigation of biomolecules binding on a single floor. The system’s output gives recordings of two acoustic parameters, part and amplitude of a Love wave, synchronized with SPR readings.
We current the design and manufacturing of a novel experimental set-up using, along with the SPR/LW-SAW machine, a 3D-printed plastic holder mixed with a PDMS microfluidic cell in order that the platform can be utilized in a flow-through mode. The system was evaluated in a scientific examine of the optical and acoustic responses for various floor perturbations, i.e., inflexible mass loading (Au deposition), pure viscous loading (glycerol and sucrose options) and protein adsorption (BSA). Our outcomes present the theoretical and experimental foundation for future utility of the mixed system to different biochemical and biophysical research.
 Label-free Electrochemical Detection of CGG Repeats on Inkjet Printable 2D Layers of MoS 2
Label-free Electrochemical Detection of CGG Repeats on Inkjet Printable 2D Layers of MoS 2

Photoluminescent and Chromic Nanomaterials for Anticounterfeiting Applied sciences: Latest Advances and Future Challenges

Counterfeiting and inverse engineering of safety and confidential paperwork, equivalent to banknotes, passports, nationwide playing cards, certificates, and helpful merchandise, has considerably been elevated, which is a significant problem for governments, firms, and clients. From latest world experiences printed in 2017, the counterfeiting market was evaluated to be $107.26 billion in 2016 and forecasted to succeed in $206.57 billion by 2021 at a compound annual development fee of 14.0%. Growth of anticounterfeiting and authentication applied sciences with multilevel securities is a robust resolution to beat this problem.
Stimuli-chromic (photochromic, hydrochromic, and thermochromic) and photoluminescent (fluorescent and phosphorescent) compounds are essentially the most vital and relevant supplies for growth of complicated anticounterfeiting inks with a high-security stage and quick authentication. Extremely environment friendly anticounterfeiting and authentication applied sciences have been developed to succeed in excessive safety and effectivity. Relevant supplies for anticounterfeiting functions are usually based mostly on photochromic and photoluminescent compounds, for which hydrochromic and thermochromic supplies have extensively been utilized in latest many years.
A variety of supplies, equivalent to natural and inorganic metallic complexes, polymer nanoparticles, quantum dots, polymer dots, carbon dots, upconverting nanoparticles, and supramolecular buildings, may show all of those phenomena relying on their bodily and chemical traits. The polymeric anticounterfeiting inks have just lately obtained vital consideration due to their excessive stability for printing on confidential paperwork.

Replacement Ink Pads for J2000

LAB0182 EACH
EUR 18.02

Black Ink Ribbon For TLS

R4310 EACH
EUR 31.58

Canon KP-108IN Ink And Paper Set

ELE0048 EACH
EUR 79.8

INK-128

9527-25
EUR 705.6

INK-128

9527-5
EUR 222

Holder for Plasmid Midi, Maxi and Maxi plus, Ion Exchange column

FAPDE-holder-for-ion-exchange 1 prep
EUR 189.6

Mettler-Toledo ink ribbon for printer RS

MT65975-1EA PK2
EUR 33.4

p15 INK antibody

70R-30703 100 ug
EUR 392.4
Description: Rabbit polyclonal p15 INK antibody

p18 INK antibody

70R-30704 100 ug
EUR 392.4
Description: Rabbit polyclonal p18 INK antibody

p15 INK Antibody

33457-100ul 100ul
EUR 302.4

p15 INK Antibody

33457-50ul 50ul
EUR 224.4

p18 INK Antibody

33458-100ul 100ul
EUR 302.4

p18 INK Antibody

33458-50ul 50ul
EUR 224.4

INK 128 (MLN0128)

A8551-10 10 mg
EUR 199.2
Description: INK 128 (MLN0128) is a selective inhibitor of mTOR with IC50 value of 1 nM [3].mTOR is an evolutionarily conserved serine/threonine kinase which combined PI3K/AKT/mTOR pathway and plays an important role in regulating many fundamental features of cell growth and division [1].

INK 128 (MLN0128)

A8551-5 5 mg
EUR 170.4
Description: INK 128 (MLN0128) is a selective inhibitor of mTOR with IC50 value of 1 nM [3].mTOR is an evolutionarily conserved serine/threonine kinase which combined PI3K/AKT/mTOR pathway and plays an important role in regulating many fundamental features of cell growth and division [1].

INK 128 (MLN0128)

A8551-5.1 10 mM (in 1mL DMSO)
EUR 184.8
Description: INK 128 (MLN0128) is a selective inhibitor of mTOR with IC50 value of 1 nM [3].mTOR is an evolutionarily conserved serine/threonine kinase which combined PI3K/AKT/mTOR pathway and plays an important role in regulating many fundamental features of cell growth and division [1].

INK 128 (MLN0128)

A8551-50 50 mg
EUR 408
Description: INK 128 (MLN0128) is a selective inhibitor of mTOR with IC50 value of 1 nM [3].mTOR is an evolutionarily conserved serine/threonine kinase which combined PI3K/AKT/mTOR pathway and plays an important role in regulating many fundamental features of cell growth and division [1].

p16 INK Antibody

20-abx119396
  • EUR 376.80
  • EUR 117.60
  • EUR 477.60
  • EUR 594.00
  • 100 ug
  • 10 ug
  • 200 ug
  • 300 µg

p15 INK Antibody

20-abx013163
  • EUR 376.80
  • EUR 117.60
  • EUR 477.60
  • EUR 594.00
  • 100 ug
  • 10 ug
  • 200 ug
  • 300 µg

p18 INK Antibody

20-abx013164
  • EUR 376.80
  • EUR 117.60
  • EUR 477.60
  • EUR 594.00
  • 100 ug
  • 10 ug
  • 200 ug
  • 300 µg

p16 INK Antibody

ABF0228 100 ug
EUR 525.6

p15 INK Antibody

ABF0230 100 ug
EUR 525.6

p18 INK Antibody

ABF0620 100 ug
EUR 525.6

p18 INK Antibody

ABF5356 100 ug
EUR 525.6

p16 INK Antibody

ABF5484 100 ug
EUR 525.6

p15 INK Antibody

ABF5486 100 ug
EUR 525.6

Ink 128 (Mln0128)

20-abx186471
  • EUR 2281.20
  • EUR 610.80
  • 100 mg
  • 10 mg

India Ink Dropper

261194 PK50
EUR 60.42

Anti-p15 INK Antibody

A01500-1 100ul
EUR 476.4
Description: Rabbit Polyclonal p15 INK Antibody. Validated in IF, IHC, WB and tested in Human, Mouse, Rat.

Anti-p18 INK Antibody

A03299 100ul
EUR 476.4
Description: Rabbit Polyclonal p18 INK Antibody. Validated in IHC, WB and tested in Human, Mouse, Rat.

p15 INK Conjugated Antibody

C33457 100ul
EUR 476.4

p18 INK Conjugated Antibody

C33458 100ul
EUR 476.4

p18 INK Blocking Peptide

AF5356-BP 1mg
EUR 234

p16 INK Blocking Peptide

AF5484-BP 1mg
EUR 234

p15 INK Blocking Peptide

AF5486-BP 1mg
EUR 234

p16 INK Blocking Peptide

AF0228-BP 1mg
EUR 234

p15 INK Blocking Peptide

AF0230-BP 1mg
EUR 234

p18 INK Blocking Peptide

AF0620-BP 1mg
EUR 234

India Ink Stain Solution

PW006 100ml
EUR 89.23

p16 INK recombinant monoclonal antibody

A5869 100ul X 3
EUR 714
Description: A recombinant monoclonal antibody from rabbit against human p16 INK for WB, IF,ELISA

p16 INK Cell ELISA Kit

abx595438-96tests 96 tests
EUR 764.4

Anti-p16 INK Monoclonal Antibody

M00016 100ug
EUR 476.4
Description: Rabbit Monoclonal p16 INK Antibody. Validated in Flow Cytometry, IP, IF, IHC, ICC, WB and tested in Human.

p16 INK Colorimetric Cell-Based ELISA Kit

EKC1417 100ul
EUR 686.4

p5 Ligand for Dnak and and DnaJ

5-01680 4 x 5mg Ask for price

p16 INK Colorimetric Cell-Based ELISA Kit (OKAG00927)

OKAG00927 96 Wells
EUR 715.2
Description: Description of target: ;Species reactivity: Human, Mouse;Application: ELISA;Assay info: Assay Type: Cell-Based
Subtype: None
Detection Method: Colorimetric 450 nm;Sensitivity:

Lab Marker Fine Tip Pen Ipa Ink Resistant

PEN40 PK10
EUR 93.48

p5 Ligand for Dnak and and DnaJ Peptide

20-abx266082
  • EUR 493.20
  • EUR 794.40
  • EUR 376.80
  • 10 mg
  • 25 mg
  • 5 mg

Brush and support for Drosophila

FLY1244 EACH
EUR 133.38

SS grid for size 55 and 75 and HCP50

CHA4020 EACH
EUR 114

Blocking Buffer for ICC and IHC

SF40011 10 ml
EUR 153.6

Permeabilization Buffer for ICC and IHC

SF40012 10 ml
EUR 146.4

Monoclonal antibody for SUR1 and SUR2B

SMC-432D 0.1mg
EUR 423.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated.

Monoclonal antibody for SUR1 and SUR2B

SMC-432D-A390 0.1mg
EUR 480
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 390.

Monoclonal antibody for SUR1 and SUR2B

SMC-432D-A488 0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 488.

Monoclonal antibody for SUR1 and SUR2B

SMC-432D-A565 0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 565.

Monoclonal antibody for SUR1 and SUR2B

SMC-432D-A594 0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 594.

Monoclonal antibody for SUR1 and SUR2B

SMC-432D-A633 0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 633.

Monoclonal antibody for SUR1 and SUR2B

SMC-432D-A655 0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 655.

Monoclonal antibody for SUR1 and SUR2B

SMC-432D-A680 0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 680.

Monoclonal antibody for SUR1 and SUR2B

SMC-432D-A700 0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 700.

Monoclonal antibody for SUR1 and SUR2B

SMC-432D-ALP 0.1mg
EUR 471.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Alkaline Phosphatase.

Monoclonal antibody for SUR1 and SUR2B

SMC-432D-APC 0.1mg
EUR 477.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC.

Monoclonal antibody for SUR1 and SUR2B

SMC-432D-APCCY7 0.1mg
EUR 564
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC/Cy7.

Monoclonal antibody for SUR1 and SUR2B

SMC-432D-BI 0.1mg
EUR 474
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Biotin.

Monoclonal antibody for SUR1 and SUR2B

SMC-432D-DY350 0.1mg
EUR 495.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 350.

Monoclonal antibody for SUR1 and SUR2B

SMC-432D-DY405 0.1mg
EUR 482.4
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 405.

Monoclonal antibody for SUR1 and SUR2B

SMC-432D-DY488 0.1mg
EUR 470.4
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 488.

Monoclonal antibody for SUR1 and SUR2B

SMC-432D-DY594 0.1mg
EUR 472.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 594.

Monoclonal antibody for SUR1 and SUR2B

SMC-432D-DY633 0.1mg
EUR 466.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 633.

Monoclonal antibody for SUR1 and SUR2B

SMC-432D-FITC 0.1mg
EUR 469.2
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with FITC.

Monoclonal antibody for SUR1 and SUR2B

SMC-432D-HRP 0.1mg
EUR 464.4
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with HRP.

Monoclonal antibody for SUR1 and SUR2B

SMC-432D-P594 0.1mg
EUR 487.2
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with PE/ATTO 594.

Monoclonal antibody for SUR1 and SUR2B

SMC-432D-PCP 0.1mg
EUR 477.6
Description: A monoclonal antibody from clone S323A-31 against Human SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with PerCP.

Monoclonal antibody for SUR1 and SUR2B

SMC-432D-RPE 0.1mg
EUR 475.2
Description: A monoclonal antibody from clone S323A-31 against Human SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with RPE.

Monoclonal antibody for SUR1 and SUR2B

SMC-432D-STR 0.1mg
EUR 476.4
Description: A monoclonal antibody from clone S323A-31 against Human SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Streptavidin.

Monoclonal antibody for SUR1 and SUR2B

SMC-432S 0.012mg
EUR 78
Description: A monoclonal antibody from clone S323A-31 against Human SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated.

Tap For 10Ltr and 20Ltr Aspirator

ASP1050 EACH
EUR 39.22

Raised Shelf for BAT3034 and 3054

BAT3142 EACH
EUR 183.54

Cool-pack and platform for MSCHOICE

MSCHOICECP EACH
EUR 144.78

Cool-pack and platform for MSMAXI

MSMAXICP EACH
EUR 153.9

Eppendorf ThermoTop for ThermoMixer and ThermoStat

E5308000003 EACH
EUR 497.04

uCuvette G1.0 for BioSpectrometer and BioPhotometer

E6138000018 EACH
EUR 1995

Tubing and connector set for 4905

HOM2714 EACH
EUR 254.22

Spiking Solution for Water and Soil

SPISL01 1L
EUR 117.42

Electrode Detectors and Cathode for CHL2000

CHL2022 PK3
EUR 79.8

Trident Screwcap for TUB1200 and TUB1202

TUB1400 PK100
EUR 13.11

Trident Screwcap for TUB1204 And TUB1206

TUB1402 PK100
EUR 13.11

Eppendorf SmartBlock for 8x5.0ml for ThermoMixer and ThermoStat C

E5309000007 EACH
EUR 589.38

ELISA kit for Human Dual adapter for phosphotyrosine and 3-phosphotyrosine and 3-phosphoinositide (DAPP1)

KTE62145-48T 48T
EUR 398.4
Description: Quantitative sandwich ELISA for measuring Human Dual adapter for phosphotyrosine and 3-phosphotyrosine and 3-phosphoinositide (DAPP1) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Human Dual adapter for phosphotyrosine and 3-phosphotyrosine and 3-phosphoinositide (DAPP1)

KTE62145-5platesof96wells 5 plates of 96 wells
EUR 2538
Description: Quantitative sandwich ELISA for measuring Human Dual adapter for phosphotyrosine and 3-phosphotyrosine and 3-phosphoinositide (DAPP1) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Human Dual adapter for phosphotyrosine and 3-phosphotyrosine and 3-phosphoinositide (DAPP1)

KTE62145-96T 96T
EUR 646.8
Description: Quantitative sandwich ELISA for measuring Human Dual adapter for phosphotyrosine and 3-phosphotyrosine and 3-phosphoinositide (DAPP1) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Mouse Dual adapter for phosphotyrosine and 3-phosphotyrosine and 3-phosphoinositide (DAPP1)

KTE71336-48T 48T
EUR 398.4
Description: Quantitative sandwich ELISA for measuring Mouse Dual adapter for phosphotyrosine and 3-phosphotyrosine and 3-phosphoinositide (DAPP1) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Mouse Dual adapter for phosphotyrosine and 3-phosphotyrosine and 3-phosphoinositide (DAPP1)

KTE71336-5platesof96wells 5 plates of 96 wells
EUR 2538
Description: Quantitative sandwich ELISA for measuring Mouse Dual adapter for phosphotyrosine and 3-phosphotyrosine and 3-phosphoinositide (DAPP1) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Mouse Dual adapter for phosphotyrosine and 3-phosphotyrosine and 3-phosphoinositide (DAPP1)

KTE71336-96T 96T
EUR 646.8
Description: Quantitative sandwich ELISA for measuring Mouse Dual adapter for phosphotyrosine and 3-phosphotyrosine and 3-phosphoinositide (DAPP1) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ExoQuick Exosome Isolation and RNA Purification kit (for Serum and Plasma)

EQ806A-1 20 preps
EUR 664.8

ThermoMixer FP with thermoblock for microplates and deepwell plates and lid

E5385000032 EACH
EUR 2839.74

XCF COMPLETE Exosome and cfDNA Isolation Kit (for Serum and Plasma)

XCF100A-1 20 rxn
EUR 776.4

Sample, Antibody and Conjugate Diluent (20X) for ELISA (For serum, plasma sample conservation and low background)

80066 50 ml
EUR 278.4

SmartBlock plates Thermoblock for MTP and Deepwell plates inc Lid for ThermoMixer and Thermo tat instruments

E5363000039 EACH
EUR 731.88

Cell Lysis Buffer for WB and IP

abx090622-100ml 100 ml
EUR 260.4

Tips, 5ml for Propette and Propette LE

P4305 250/pack
EUR 98.88
Description: Tips 5ml for Propette and Propette LE

Protein Extraction for Fixed and Embedded Tissues

P525-20 - Ask for price

Antibody Dilution Buffer for ICC and IHC

SF40010 10 ml
EUR 146.4

Falcon Cushion For 175ml And 225ml Tubes

352090 PK8
EUR 79.8

Grant Raised Shelf for S12 and P12

BAT3540 EACH
EUR 100.32

Grant Raised Shelf for S18 and P18

BAT3541 EACH
EUR 150.48

Gabled lid for 18 And 26L Bath

BAT5056 EACH
EUR 302.1

Grant Block Cover for QBA1 and QBD1

BLO1332 EACH
EUR 116.28

Kerosene Blank for AA and ICP 500mL

KER-BLK 500ML
EUR 45.6

Cl Buffer for Wallace and Tiernan Monitor

CWM25 25L
EUR 362.52

Battery for MDF-U54V and MDF-U74V

DD99240 EACH
EUR 272.46

Ecosafe Tank and Work Top For H06

FUM1004 EACH
EUR 221.16

perforated SS shelf for ICO105med and ICO150med

CHA4028 EACH
EUR 176.7

Propellers for HI-931 and HI-932

TIT1026 PK3
EUR 25.31

5 Litre Bag for arium mini and +

WAT4294 EACH
EUR 49.02

Dual Adapter For Phosphotyrosine And 3-Phosphotyrosine And 3-Phosphoinositide (DAPP1) Antibody

abx224298-100ug 100 ug
EUR 493.2

Immuno Diluent and Block (Clear), 125 ml; For diluting and storing antibodies

NB307-C 125 ml
EUR 456

Welch Replacement Cartridge For Ome 10/16 And 10/25 (and Akd)

PUM9132 EACH
EUR 74.1

Antibody and Conjugate Diluent for ELISA concentrate (10X)

80070 50 ml
EUR 242.4

Miniprep Kit For Plasmid DNA Extraction And Purification

MB1005-100Reactions 100 Reactions
EUR 171.6

Miniprep Kit For Plasmid DNA Extraction And Purification

MB1005-250Reactions 250 Reactions
EUR 310.8

Miniprep Kit For Plasmid DNA Extraction And Purification

MB1005-50Reactions 50 Reactions
EUR 144

ELISA kit for Human Coxsackievirus and adenovirus receptor

EK3312 96 tests
EUR 663.6
Description: Enzyme-linked immunosorbent assay kit for quantification of Human Coxsackievirus and adenovirus receptor in samples from serum, plasma, tissue homogenates and other biological fluids.

Mitochondria Isolation Kit for Tissue and Cultured Cells

KC010100 1 kit
EUR 384
Description: Can be used for various proteomics studies in both normal and pathological cases. It is an excellent control and suitable for educational purposes. This product is prepared from whole tissue homogenates and has undergone SDS-PAGE quality control analysis. The protein is stored in a buffer with protease inhibitor cocktail fo prevent degradation.

Nuclei and Cytosol Isolation Kit for Adipose Tissues

P529 - Ask for price

Rat Creatine kinase for muscle and brain (CKMB)

QY-E11888 96T
EUR 448.8

Tips 10mL for Gilson Rainin and Eppendorf Bulk

4530-00 PK100
EUR 43.32

Replacement PC lid for 2 and 5L baths

BAT3036 EACH
EUR 91.2

Replacement PC lid for 18L and 26L Baths

BAT3039 EACH
EUR 123.12

Gabled Lid SS for 2 and 5L baths

BAT3120 EACH
EUR 173.28

Gabled Lid SS for 18L and 26L Baths

BAT3124 EACH
EUR 216.6

Grant Block Cover for QBA2 QBD2 and QBH2

BLO1334 EACH
EUR 124.26

Duran Stirred Reactor for 500mL and 1000mL Bottles

BOT1140 EACH
EUR 319.2

Kerosene Blank for AA and ICP 1 Gallon

KER-BLK-G 1GALLON
EUR 143.64

Foilstrips Aluminum self adhesive for PCR and storage

MOL2260 PK50
EUR 68.29

Lid for Dewar 1 l (091717 and 091727)

DD91723 EACH
EUR 66.12

Conductivity Probe for HI-9033 and HI-9635

HI-76302W EACH
EUR 258.78

Tubing and connector set for cup horn 4905

HOM2710 EACH
EUR 332.88
As well as, the printing applied sciences together with hand-writing, stamping, inkjet printing, display printing, and anticounterfeiting labels are mentioned for introduction of essentially the most environment friendly strategies for utility of various anticounterfeiting inks. This overview would assist scientists to design and develop essentially the most relevant encryption, authentication, and anticounterfeiting applied sciences with excessive safety, quick detection, and potential functions in safety marking and data encryption on numerous substrates.

Leave A Comment